SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si000332m|PACid:19678553 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si000332m|PACid:19678553
Domain Number 1 Region: 492-783
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-73
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 69-165,197-227
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.09e-27
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Weak hits

Sequence:  Si000332m|PACid:19678553
Domain Number - Region: 391-425
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Pan module (APPLE domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si000332m|PACid:19678553
Sequence length 816
Sequence
MAAPRGRSAPACVLLPLLLGFVLLLQGAPSQAGDTVAAGRPLSGGDSLVSKRGKFRLGFF
QPDNSSDHWYLGIWYNQISLHTTVWVANREAAITDPASSQLSIASDGNMVILDHRRSTVW
STNVTGVVASNSTTVGVILDTGNLVLADASNTSAVRWQSFDHFGDTWLPGGKLGRNKRTG
EVTQLVAWKGYNDPSPSPFSLELDPGGSSQYLLKWNGGEQYWSSGNWTGHAFTAVPEMTP
TDASPLSKYTFGYVDGADESYFVYDVTDESVVTRFLFDVTGQIKFLTWVEAAKEWMLFWS
EPKKQCDVYAVCGPFGVCTENALPSCSCPRGFSQRRPGEWLQNDHTAGCARNAGLACSDR
DGQHQKNSKNDDDRFYTMDDARLPSSARSAAAASARDCELACLGNCSCTAYSYTGGGGCS
LWYGDLINLQDTTASGGGSSISIRLAASEFSGTGNARKLVIGLAAAGSVAAVAAIVLATI
LILRSRRIKSLRRVEGSLMAFTYRDLQFVTKNFTEKLGGGAFGSVFKGSLPDATPVAVKK
LEGVRQGDEAQFRAEVSTIGTIQHVNLIRLLGFCSERTRRLLVYEHMPRGSLDRHLFGAS
SQGGVLSWETRYQIALGIARGLEYLHDKCRDCIIHCDIKPENILLDEAFVPKVADFGLAK
LMGRDFSRVLTTVRGTVGYLAPEWIGGAAVTTKADVFSYGMMLFEIVSGRRNVGQRGDGA
VDFFPATAVGMLLDGDLRGAVDCRIAGEADVAEVERACKVACWCVQDAESLRPSMGMVVQ
VLEGLVDVDVPPIPKSLKVLADPAKYVEFFSGLPST
Download sequence
Identical sequences K3XEL5
Si000332m|PACid:19678553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]