SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si003766m|PACid:19676939 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si003766m|PACid:19676939
Domain Number 1 Region: 80-188
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.36e-22
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  Si003766m|PACid:19676939
Domain Number - Region: 368-404
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0118
Family Anti-platelet protein 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si003766m|PACid:19676939
Sequence length 462
Sequence
MPSTYIFIPVSFCILIIATSLCSAADTISAGQTLAGRGGKLVSKNGKFALGFFQRSTGSR
SSTPKWYLGIWFNTVPKLTPAWVANRENPLLDGTSSELIISDDGNLAIFNRPNRSILWSS
QANTTTNNTIAVLLNSRDLVLSDASNSTTIFWRSFDHMTDTFLPGARVSRNKVTGWTHGL
VSNKNSHDLSPGIYSGRPSPESANFELLLSWNSSVTYWSSGQWEGQYFSNMPEMSARYLF
FSEFVSNDREEYYTYWLKNETMVTRYVLDVDGQAKMMLWSDASAEWIFFYPKPGAQCEAY
AVCGPFTVCREDVLPFCNCMKGFSIRSQEDWELGDRTGGCNRNIPLNCASSNSGISGDLT
DMFYAMRNVIYPDNAKHIETGSAEECEKSCLGDCSCYAYSYSVKRLDGARQGEKEFRAED
HESRRLTMGEVVRILEGLIKVDVPPMPKVLEAISGGTDSTIA
Download sequence
Identical sequences K3XPE2
Si003766m|PACid:19676939

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]