SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si004221m|PACid:19674819 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si004221m|PACid:19674819
Domain Number 1 Region: 109-183
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000000144
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  Si004221m|PACid:19674819
Domain Number - Region: 206-281
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0654
Family SGL-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si004221m|PACid:19674819
Sequence length 459
Sequence
MEAAKRVCSLSRPREPAPPTFLLVLLGGAFLALAAFAGDTIVPGEGISGNQTLVSKNGEF
ELGFFAPGAGIQRFLGVRFKKMPSTSPTFWVGNRVPITDLSAAALEVFGGSLCIKEAGAS
LWCSSVAADGPPPPAAAAVLLDTGNLVVRDRANSSRILWQSFDCPGDSLLPGARLGLDRD
TGSNVSMTYMDYPHDGSISVDQSRRNGFVLTTDGLDSLGTFPDWMVTSQDNGRSLVLNRP
GPNVTEFLQFHLGQVSLMRWSEDSAAANGSGWVARWTFPSDCKSSGFFCGNFGACKSNGR
CNCLDGFEPSYPVEWGLGYFVTGCSRSLPLSCEANGRTEQDDSFILMDKLQGLPYNPQND
LAESDGDCKQACFSKCYCVAYVYDSGCKLWLEGNANVKELDITCRVACWCIQDEENDRPS
MGQVVRMLEGVVNTEIPPIPSSFQNLMEGENSCIYSDEG
Download sequence
Identical sequences K3XQN4
Si004221m|PACid:19674819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]