SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si007945m|PACid:19702804 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si007945m|PACid:19702804
Domain Number 1 Region: 1317-1567
Classification Level Classification E-value
Superfamily BEACH domain 6.15e-102
Family BEACH domain 0.000000078
Further Details:      
 
Domain Number 2 Region: 1678-1934
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.36e-38
Family WD40-repeat 0.0084
Further Details:      
 
Domain Number 3 Region: 1158-1200,1238-1302
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-19
Family PreBEACH PH-like domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si007945m|PACid:19702804
Sequence length 1950
Sequence
MACACAIELLDLLEQFELATWKYAKVNEAMTHCTIGTELKPVGEEPISIGFEKTFAFTGQ
MGPVYVFSDALSSEQASDGRSLFSVSSALDNADKSTFEAAIMGGTKLCSRHLPQDIIYCV
GGVSVFFPLFTQFFDAAIDVVQSCHTPVGNDKLAAEVIELVATVLDGNVSNQQQMYLLSG
LSILGFLLQSATPQLLTTKTLSALKYMFDILRNCGMSKILLKDAISQIYLNPQIWVYASY
EVQRDLYMFVIKYFETDGRLLPLLCQLTWIIDIVCRYYWEKADSRHVAASKPLLHPVTKE
VIGERPKIVEIRKLRLLFLSLAEMSLKLKSSPDDIRALVAFFERSQDIACIRDMLDTIIP
ALSQGSVLSSFVENVNCLGGCCIFINLLKSSFFREFEPVRLLGLQLLGKLLAGIPSEKKG
MKLFPLPLVQSRSISENLTKEITAAPQLFFYAISERLFKFPLSDNLCAALFSVLGGTTPQ
QVLQENSQSDPSRDKNCNLSSSAPFSLPQILVCIFRYMHSCQDSSARRRILNDLLGLLDS
NPSNIEALMEHSWNSWLESSTKLDVFKDYKSVSKGELDDGDTDEISLVRNLYSLVLSYYL
RSVRGGWHQLDDTTNFFLLKLDQGQLSSFDLLRDILDDIAGSLLQKSVKDNIFLFQPCCD
NVLYFLNLIQELLVNQMGIKLLFPSSNLSEESSHDNMWKEDIKSIVNDILNTESNGQYTR
FSDGKKVSDDWWSFFDKVWSIICNLNRKGPSKLLQKDPNVDVASLGLMESVNVPTPEKAA
VVVSEGIGTALGVKTNRFTEKTIMSREEIIPRVFFHLVILYLCKAGSENASKCVLQFMSL
LPILLISEDDQSKNKLHFLIWSLLIVRSQYGQLDDGARFHVCSHLILETIIYGKSMLVTN
ILGRDDSMEVNKNKETGFILSFIQKDRIFAAAADEVKHMKAVQADRLKQVQELQFKLNES
SRKETRLVQAIEDEIHFTVTAALSADDGRKAASQLAFREDQQMITDKWIHISRALMDERG
PWSANPFPNDVVTHWKLDKTEDRWRRRFKLKRNYKFDERLCQPSQSRNESTCPSADQPYI
SAKIPEKMKRFLLKGVRGITEDSGYEPSEDTSDASESSQSNPLESQNQNNAADSSDYHST
VHDKKEPSSTNGDNDYTKVLCSVRCVLVTPKRKLAGYLDITRTVMHFSFEFLVEGTGGSS
VFSKFKDKKDSDCKNELGGVDRLDGCRDGMIETNGVLMQNQSNKIKRHRRWNITKIKGVH
WTRYLLQYTAMEIFFDDSSAPIFLNFSSQKDTKNAGTLLVSLRNEALFPKGSIKDKNSII
SFVDRRVALEMAENAREIWKRREISNFEYLVILNTLAGRSYNDLTQYPIFPWVLADYTSE
KLDFNKSSTFRDLSKPVGALDENRFKGGKFDHADRLFHSIDSAYRNSLSSTSDVKELIPE
FFYMPEFLENSNSYHLGVKQDGEPIGNVALPPWAKGSPDEFIHINREALESEYVSSNLHH
WIDLIFGYKQRGQPAVEAANIFYYVTYEGAVDLENMDDMLQKSAIEDQIANFGQTPIQIF
RMKHPRRGPPIPIAHPLYFAPQSIILTSSVSRTISHMCAVLFIGLLENTVVLMNEGLILS
VKLWLTTQLQSGGNFTYSGPQEHFFGISSDVISPRKIGTFLAENVEFGRHCLATMQNNGD
NYLILCGNWENSFQIISLSDGRIMQSIRQHKDVVGCVAVSSDGNVVATGGYDTTVMIWHA
FRGRPIDKKLRTANFELSEKEHVIVERPVHILCGHDDIITCLFVSTELDIVISGSKDGTC
IFHTLREGRYVRSIQHPSGVGFSKLVASQHGRVVLYSENDLSLHMYSINGRHIASSATSG
RLNCMELSCCGEFIACAGEKGHIVLRSMHSLDTVWRYDGAGKTITSLAVTPEECILAGTK
DGSLLVFSIETPLLRRGSMQRNRIKPSTTG
Download sequence
Identical sequences K3Y182
Si007945m|PACid:19702804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]