SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si012380m|PACid:19695085 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si012380m|PACid:19695085
Domain Number 1 Region: 90-162,262-287
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000168
Family alpha-D-mannose-specific plant lectins 0.0092
Further Details:      
 
Weak hits

Sequence:  Si012380m|PACid:19695085
Domain Number - Region: 368-407
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000263
Family Pan module (APPLE domain) 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si012380m|PACid:19695085
Sequence length 495
Sequence
MRRGKGDPAIAAVMGVLCVASAVLVVAGAKGGELTTQLLNGFTATHAAGAAAAFEPLLYA
TNGVFAFGFLRVGTASLDLAVVHLPSSFPLWRATPARLGDWSRPATLTFDSSLVLTDEDD
DVLWRTLDTIGDVVVLLNSSNLVLRRYSKPVPAWQSFHNPSDTLVLDQNFTASSPPLISS
NRRFAFRLGKTYMALHMEFNGGRTTPIYWQHTALEAQPQNATEPPVYGRLDGRGFFGLYL
EGGGQKVDVLSFDTFVQNLTGVFRRMTLDDDGNLRAYYWTDGAKGWISDYRAIAERCELP
ASCGAYGLCVPGTAQCQCLDNTTTSTSPQCHAGETADLCATDGRQQLDFDVVRRKQVSVA
YKEELPPETNRTAEECEAACAGNCSCWGAVYNGASGYCYLMDFPVETLVYEADDRKVGYF
KVRKVPSPKRARMSPGVAAATAVLSLILAGLAAAGAYSGYRLWERRRRKRAGMEQELVPG
PYKDLKTMGSSNSSF
Download sequence
Identical sequences K3YDS3
Si012380m|PACid:19695085

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]