SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si024768m|PACid:19697900 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si024768m|PACid:19697900
Domain Number 1 Region: 406-719
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.28e-73
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 301-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000724
Family EGF-type module 0.0094
Further Details:      
 
Weak hits

Sequence:  Si024768m|PACid:19697900
Domain Number - Region: 269-312
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00838
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Si024768m|PACid:19697900
Sequence length 742
Sequence
MEEALVLLIIVAFSVIAPATSSGLTISLPGCPDKCGNVSIPYPFGIGDGCAATSLSPSFT
LICNNSFQPPRPMFSNSSRPVEVIDISLEHGEVRVYGNVSYYCFTSNTTISDNNTAGVSL
ENMPFIPSITRNRFTVIGCNTLGLIGGYTHSNSDLYLAGCYSYCRGINSTTDGAPCIGIG
CCETTISPNLTDFAALLINNQSSVWSFNPCFYSMLVEVGWYSFRRQDLVGHLGFIKERAK
RGVPVVGDWAIRKGSCPKDGTKAPKDYACVSTNSYCVNASNGPGYLCNCSQGYEGNPYLS
NGCQDIDECKLRKQDLKYKELYPCKNGICRNIPGGYICKCRIGTRSDEHHCAGLSASAVV
VISLTCLLVMKLQQRKHRREKDAYFEQNGGLKLYDEMRSRQVDTIQILTEKEIKKATDNF
SEDRVLGCGGHGMVYKGTLDDNKEVAIKKSKVIDDDCREEFVNEIIILSQINHRNIVRLL
GCCLDVDVPMLVYEFIPNGTLFEFLHVTDARSPIPLDLRLNIATQSAEALAYIHSSTSRT
ILHGDVKSLNILLDNEYNAKVSDFGASALKSMDKNDFIMLIQGTLGYIDPESFVSHHLTD
KSDVYSFGVVLLELMTRKKALYRDTSNEKKSLSHTFILMFHRNELRSMLDTEIVDDQVMV
VLEKLAELVMHCLSPKGDERPTMKEVAERLQMLRRLQMQLVTKMHPNQAHYSCQESSMSV
PSGMGYQSTETAKLVLDVDLAR
Download sequence
Identical sequences K3ZDX6
Si024768m|PACid:19697900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]