SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si035120m|PACid:19685903 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si035120m|PACid:19685903
Domain Number 1 Region: 94-353
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.23e-43
Family Protein kinases, catalytic subunit 0.001
Further Details:      
 
Domain Number 2 Region: 425-521
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000166
Family Tetratricopeptide repeat (TPR) 0.0092
Further Details:      
 
Weak hits

Sequence:  Si035120m|PACid:19685903
Domain Number - Region: 27-35
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00199
Family Formin homology 2 domain (FH2 domain) 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si035120m|PACid:19685903
Sequence length 530
Sequence
MGCCRSSLRAGAGAGTHAAEKPPRHRPPPPPPPPPTNRSSSFSLNAHQAAPSARAGAGGG
GGDVPAFAEFSLADLRAATGGFAAANIVSESGEKAPNLVYRGQLKGPAGGAPPRAIAVKK
FAKLAWPDPKQFAEEAKGVGSLRHRRMANLIGYCCDGDERLLVAEFMPNDTLAKHLFHWE
NQTIEWAMRLRVAYYISQALEYCSTKGRPLYHDLNAYRVLFDESGDPRLSCFGLMKNSRD
GKSYSTNLAYTPPEYLRNGRVTPESVIFSFGTVLLDLLSGKRIPPSHALDIMRGRNIQAV
MDSHLEGNYSIEVATTLVNLASQCLQYEPRDRPDIKKLVSILEPLQIKLEVPSYVMLGIP
KPVEEPQAPPTPQRPLSPMGEACSRMDLTAIHQILFTTHYRDDEGSNELSFQEWTQQMRD
MLDARKRGDFAFKDKDFKAAIDCYTQFVDVGTMVSPTVFARRSLCYLMCDQPDAALRDAM
QAQIIYPDWPTAFYMQAVALSKLNMQSDAVDMLNEASQLEEKRQKSTKGP
Download sequence
Identical sequences K4A8B4
XP_004983786.1.39314 Si035120m|PACid:19685903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]