SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si036701m|PACid:19683199 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si036701m|PACid:19683199
Domain Number 1 Region: 102-191
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000995
Family alpha-D-mannose-specific plant lectins 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Si036701m|PACid:19683199
Sequence length 315
Sequence
MQLSFLPHVAICLALAFLLPSHAAVTAAPAGTIQRVTKQQILASIPPHWDENPVLFLTSP
SGKYAAYFMRSQTTPGAGGLGADFCYVEVLDTTAPGAEGRSVWESECLAVSTVNTCALVF
SWKGLEVFDGSTSVWHTHDTKSDDQNFLETLQLVDQGDMRILDKGGELAWKASDEPRAAQ
HCGMPGSPGLASALPPFAEPIGHGSSDLPFGFGQGAGGVGVGGVAQPEAPLAAPLPQPEL
PLAPLPQEADEFGGAAAAAAAQGQAGAGAGEAFGFGNQPLVDNSPYDSGALKHGFSLLIS
LAFCFSVAVAMGLAL
Download sequence
Identical sequences K4ACU4
XP_004985021.1.39314 Si036701m|PACid:19683199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]