SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Si038620m|PACid:19682183 from Setaria italica v164

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Si038620m|PACid:19682183
Domain Number 1 Region: 147-354
Classification Level Classification E-value
Superfamily Ribosome inactivating proteins (RIP) 8.91e-32
Family Shiga toxin, A-chain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Si038620m|PACid:19682183
Sequence length 366
Sequence
MRDGITKDKARDDGAKMRPDGKHSKDGKEEQALGEKTRVKWPLQRRTTAGKKEKTRVKRS
LQPRCRTGGSTLLLVWMMILVRAHAVQCGYVPVDVTTEEFYLTERPHAEIFGIIYNIAID
VIPRLEVRGHHFLGVKDPERLDLGGDGSAPGRWIKVPLRGETDEDRVTLCFADTDLYLLA
FMNNVGTWHCFRGYENMFPGCVVLNPVTDKNHPDFWNEQYPQLITDGFKKMHTVPLGKRS
ALEAARILGRHRHGTTPLPELKSALLRSMIMFSEAFRFRVIREAFSGDLWETETHLTQPQ
AALVVNWTNISVLLWKWDREGKWPENRLSRAVKDETEISSAEEALDVVDLLRRPRAVRIR
VAGKGD
Download sequence
Identical sequences K4AIB0
Si038620m|PACid:19682183 XP_014661266.1.39314

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]