SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC5361 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC5361
Domain Number 1 Region: 12-183
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 8.3e-32
Family G proteins 0.00016
Further Details:      
 
Domain Number 2 Region: 179-218
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000667
Family SOCS box-like 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OVOC5361
Sequence length 279
Comment pep:known supercontig:Cameroon_v3:OVOC_OM2:10382382:10385195:1 gene:WBGene00242170 transcript:OVOC5361 description:""
Sequence
MCIATSELYREEHEYMLKFLLVGDSDVGKDEIANFLGPSVSFTPNAFLILPKMTTILLEG
KFVRLQDASGQGRFSTIIKSYSRGVQGILLVYDITNRWSFDGIRRWLTEIDEHAPGVPRI
LIGNRLHLEFNRAVPRREAEYFARKRNMQYFEISTLAYFNVHESITELARLVISRNGMHW
LWKSFQVASLQDLCCRAIVKNILNVHAIDRLPIPSFLQLKVRSFASGADLCMSNVIKREC
TTPYCNSASKYITRFVRSRNTKDHSRNANCDIMPTLEAV
Download sequence
Identical sequences OVOC5361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]