SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC12304 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC12304
Domain Number 1 Region: 64-106
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000536
Family SOCS box-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OVOC12304
Sequence length 109
Comment pep:known supercontig:Cameroon_v3:OVOC_OO_000007:60391:61648:-1 gene:WBGene00249113 transcript:OVOC12304 description:""
Sequence
MSTRIEEAKHQLRDINDLRHLLNDLRMKIIEARINFIYYRWKYLVIDELLLRLSRPDMKI
GKEEVPTLLHLCRLAIRKSFPASQLANGRFVENLPIPSSLKDYLRLLSL
Download sequence
Identical sequences A0A044RME0
OVOC12304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]