SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC312 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC312
Domain Number 1 Region: 1482-1740
Classification Level Classification E-value
Superfamily YWTD domain 9.16e-48
Family YWTD domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 3284-3550
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-44
Family YWTD domain 0.00000937
Further Details:      
 
Domain Number 3 Region: 384-644
Classification Level Classification E-value
Superfamily YWTD domain 1.96e-38
Family YWTD domain 0.0000403
Further Details:      
 
Domain Number 4 Region: 2099-2344
Classification Level Classification E-value
Superfamily YWTD domain 4.45e-32
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 5 Region: 1816-2025
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-28
Family YWTD domain 0.00025
Further Details:      
 
Domain Number 6 Region: 2419-2674
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-27
Family YWTD domain 0.00022
Further Details:      
 
Domain Number 7 Region: 747-956
Classification Level Classification E-value
Superfamily YWTD domain 1.12e-26
Family YWTD domain 0.0015
Further Details:      
 
Domain Number 8 Region: 4154-4437
Classification Level Classification E-value
Superfamily YWTD domain 1.06e-24
Family YWTD domain 0.00032
Further Details:      
 
Domain Number 9 Region: 1369-1471,1741-1782
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000157
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 10 Region: 1044-1078
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000406
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 11 Region: 1172-1213
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00058
Further Details:      
 
Domain Number 12 Region: 1296-1333
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000367
Family LDL receptor-like module 0.00087
Further Details:      
 
Domain Number 13 Region: 3102-3143
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000406
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 14 Region: 1211-1254
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000877
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 3927-3966
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000903
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 16 Region: 3153-3190
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000111
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 17 Region: 3067-3102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000131
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 18 Region: 4018-4054
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000209
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 19 Region: 1259-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000262
Family LDL receptor-like module 0.00099
Further Details:      
 
Domain Number 20 Region: 3721-3756
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000275
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 21 Region: 3635-3675
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 22 Region: 1134-1172
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000393
Family LDL receptor-like module 0.00074
Further Details:      
 
Domain Number 23 Region: 3846-3882
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000432
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 24 Region: 204-244
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000484
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 25 Region: 3229-3277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000607
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 26 Region: 247-284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000641
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 27 Region: 3678-3716
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000785
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 28 Region: 38-75
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000851
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 29 Region: 3596-3632
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 30 Region: 2794-2836
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000183
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 31 Region: 166-203
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000236
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 32 Region: 2758-2796
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000445
Family LDL receptor-like module 0.0019
Further Details:      
 
Domain Number 33 Region: 2977-3007
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 34 Region: 3885-3921
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000115
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 35 Region: 3802-3840
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.00093
Further Details:      
 
Domain Number 36 Region: 2840-2876
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000314
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 37 Region: 1090-1125
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000353
Family LDL receptor-like module 0.00089
Further Details:      
 
Domain Number 38 Region: 2922-2962
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 39 Region: 79-128
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 40 Region: 3762-3796
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000157
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 41 Region: 3202-3242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000021
Family EGF-type module 0.011
Further Details:      
 
Domain Number 42 Region: 3014-3062
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000034
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 43 Region: 4102-4132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000479
Family EGF-type module 0.0083
Further Details:      
 
Domain Number 44 Region: 4067-4112
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000718
Family EGF-type module 0.013
Further Details:      
 
Domain Number 45 Region: 2886-2924
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000157
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 46 Region: 3554-3594
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000283
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 47 Region: 127-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000916
Family LDL receptor-like module 0.0015
Further Details:      
 
Weak hits

Sequence:  OVOC312
Domain Number - Region: 2055-2096
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000115
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 3970-4011
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000668
Family LDL receptor-like module 0.0031
Further Details:      
 
Domain Number - Region: 293-335
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00234
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OVOC312
Sequence length 4720
Comment pep:known supercontig:Cameroon_v3:OVOC_OM1b:2407082:2441084:-1 gene:WBGene00237121 transcript:OVOC312 description:""
Sequence
LFIQLFIFECQVKSKNQVASIAVPSPGSISASIHSGTTGCSENDFRCNDGKCIRFEWKCD
GSGDCTDGEDEKDCPHPGCKTDQWQCDRYEWRSTSCIPEYQRCDNITDCADGSDEVDCRY
VSCNVNDGSVFQCADGRQCFDISKKCDGKYDCRDLSDEKDSCPHNHTACFQYQFRCADQS
QCIQKSWVCDGSNDCADGSDEPSTCEFKQCSGSEFQCKNKRCQPRKFRCDYYDDCGDNSD
EEGCGQYLCPPQQWNCPGSGHCIHKTKLCDGKNDCSDGADEKNCSSNLCPSLGCQAGCHS
SPSGGVCTCPVGYKLDERFHRTCSDINECVEWGYCDQGCQNHRPGFTCSCLGECYHLEMM
HGPGNDNQTLRGYCLSRDADTMRLYIARREGLYRINPKNPNEEAEKLVSGEFIYGIGFDF
GDKKIFWTDRLSHSAFSADIDDSGDIKNIKKLDLKNLVFPRNLAVDWITNHLYIVESGSR
RIDISTFDGARRTVLIADGLTLPLDIALDPIRGEMFFSNQFKLESAAMDGSHRRTLIDTH
THQVSGVVVDIAAKRVYWVDPKVDRVESIDYNGNDRRIVVQGMNNVPHPFGLTIFDQYLY
WTDWTRLGVMRVEKFGSPTDIIWTKKENNVFPMGIMAYHPMVQPGPQESECLGLKIDNPC
IEANCQGMCILSKDSDGFGIGYRCVCPIGQKLIDGKRCIDSTDYLLFSSNKIVRGIFPEM
VQNSLSEAILPISPVSQRRIGMYFEVECDIHGNSFFYADIMDNTVYRVRPDGEGSAPVLV
THNDGLISMSFDWLSKQLYYVDNIRNSLEVVKISEQGLVHPDQLIHRQLLNSLREPVAVA
VHPWRGLLFFAEAQRPAKIYRCMIDASNCQIIRNTTLGRPSSITIDFSEDRLCYADTLLK
TINCMNFDGSNPYVLPVDNPIPAAITILKDELYYIHQRPYSIRRVNKRNGGKSRIVREFA
GKDRSVFSLKACSPSNQPIPDPSIEHPCHSSDCSQFCFGLPNTSSSSEAQPLVKRCGCRQ
GFKINPENMRTCQRDRREVIEILCASNSSQFLCANGRCIPNEWKCDGENDCLDGSDERGP
DGKPCFVEKECPPNTIRCNNTKKCIPQQYACDGDNDCGDYSDEDVKYCKNGEIPVCAARK
FQCDNHRCIPEQWKCDSDNDCGDGSDEKLEMCSNATCSSNQFTCGNGRCIPVYWLCDGDN
DCYDNTDEDKERCPSALCRPDQFRCANRRQCIPLKNHCDGQQDCDDGSDEESCLIQENKC
SHNEFTCVSDGICIPILWKCDGQKDCEDGSDEPEGLCSNTLCSKDHFKCANGRCIFNTWL
CDGENDCGDNSDEDVEHGCQRSQQLIIRCPFEHSLECVTDQQTTYTYVCIPYHNLCDGKD
HCPGGTDEGGRCARDLCAADRAGCAFKCHMSPNGPLCSCPFGEALVNKTKCEPENECLDA
RSCSQTCTDEKHGFTCSCEAGYTLDADKRTCKVTDGVQDMRIYVSNRNRIYWSDHLLENW
HTFEARVENAIALAWDSIEDRIYWSDIREKKIFSATRNGTNVTIFISEGLDVTEGIALDW
IARNLYWVDSSLNTIEVASLERPDARAVLIHENVDQPRGIAVDPREGLLFWTDWGQNPRI
ERANMDGSERRVLVNSKIYWPNTIALDLTTNRVYFADSKLDYIDFVNYDGTGRTQVLLST
KFVQHPHALAIFEDMIYYSDRRLQRLQLYPKYPNGTSIEYPSHTFSKALGVTAVHPILQP
HFQNPCAANSCSDLCLISRNKKSTCKCPLGKVLDASGKKCISDLKPFLMLIQKTNIFGLS
MDEAVNGTPSLSGMIPLAGLSNAYDAAYNPESAEIFYLEHATTVSEIQITASQIPDDSYA
MAMDWIGRNMYVANRISQTIEVVRTKDIQYRATVLNNDQSPTAVANPVALAIDSDRGLLF
WLDRGGGAISPKVVRADLDGKNALVIASNDLTELNHLALDTVNQRLYFSESKAGRISFVT
YDGQDRRYVLNDVGKQPRGIAFFNNRLFYADSAFDSIEVTNLSNDGQISQFQHFKKDVDQ
LINIKAISGRSGHSHPCQTNNGNCEHLCIPKAFSQHQCMCATGFVLDGSTHCKLFDRSFL
IVATKTQITGIPLNKEQKRSIAMEPIGGTAITAIDFEFESKSLFIAETSGPNRGIYKVTL
GSGEVKNIVRDSFGSFAVRSIAIDWINYNLYFINVDSDRTHIEVCQLDGKHRKILLSTKT
ETPTSLAVDPIGRYLYWADQGQKPSIQRAFLDGSHRQVVVHENIAEPTDLVVDPNSHMIY
WTDAKLDGIYRVRGDGGPVELVRSDIAAAAGISLLGQTMYWTDNRLEKIFSASSRPNQTS
ILFSPTTIAAGLSDLGDVIVFDESVQPKASTPCQITDNLRKTPCTQLCFTSPGSQSPLCA
CARGVLKGRSCEEPETFLMFADGNYIVDTPIEPDVKASNPLKEALPQIENLQTFDVDVNL
RRIYMVTESSNGANISWFAMNQPAKRRLIFGPTKNKLAESVRHISDMKLDWLTHKIYFTT
GRGGKVYVVDVQGMHAATIANGDWTYALALDPCAGFIFWSDSGYKITGGMYEPRIERANM
AGGNRRIVLKEGISLPAALAVDFREQRLYWADINKLNIESSDYDGNNRRTVGVGYRAKSL
DIWGQWLYMSDPLANGIFRMNKNSGIDYQNVVSDRRVPSVLRVIASESDTRTRNQFCNTY
ISSLCKKDNGGCEQLCHVVASESVGMTSKVQCACNDSFELVTEPGKDIATQCVPREATCQ
PPYNFQCGDGACIALSETCNGKEDCSDGSDEHATYCNTRVCPERYFLCINRRCIDAERHC
NNVDDCGDNSDETDCAVTSSACPPGHFECSNGHCINSSKVCDGHNDCHDEKVSDENKETC
PDLPIDCRGVRIRCPNTNICIQPADLCDGYDDCGDKADENKLFCMNQQCATHYVRCPSGR
CIPETWQCDGDNDCGEGAWDENHTNCTDSNGKRICLGEYLFQCANGKCISRAFICDGEDD
CGDASDESIIHNCGNRTCTDQEFHCKSNVHLAQPKYECIPKSWLCDGDVTCANGEDESKE
LCGVEKKECNKGEFRCANKHCIHASWECDGDNDCLDGSDEHANCTYSQCQPEFWQCANNK
CIPNSWKCDGNDDCDDGSDEKDCGDRNASALITNSSCPVGQFQCISGDCIPATKVCDRVY
DCPDKSDESSKCFINECSNAEKPLCEQKCVDLPIDYRCDCFDGFALDKYDKKSCHDIDEC
ETGLGRCSQKCENKIGTYKCWCVDGYAISNDDRTCKRISTDPEPWLLFANKHYVRKLTLD
GENYELVARGFENVISMDIDMTEEKVYLVDSGKLRLYRVGMEELNQPIDSYEVVLRHNVF
GTEGIAIDWIGRKLYMLNRQERSLHVCELDGRYCRTLIRDRIAQPKAIVVHPEKGYLYFT
EWSLQAYIGRISLDGSPQLVDPIEKLAENDLGWPNALAIDFFADKLFWADAHLNEVGFMN
LDGGGRYHIPAKRTSHISSLTVFDDYLFWSDWNLREIIRVDKWTGMNETVLKMTTQLPSD
IRVIHPFRQPKYKNRCGDNNGGCSHLCLLSAHDPGFTCSCPDQFVLLADNKTCEPHCTDR
QFACGGDDAKCIPKLWYCDGERDCGDGSDEPGKEICGPRICAVGEFQCNNHNCTRPFQLC
DGNDDCGDGSDEVECDKPCDPWMFKCTGNGKCIPKRFLCDGDDDCGDRSDEADTICKNKE
RNCTAEEFRCSNHKCIPKMWKCDNDDDCGDGSDEPSECINTECRKGWTRCSTSYRCIPNW
AFCNGQDDCRDNSDEILERCPACDGIGEFRCATSGKCIPKRWMCDSENDCGDNSDETDPS
CGGTSRPCSESEFRCSDGRCIPGNKVCDGTVQCADGLDESQCKLRDCNAGYVKCDDGTCI
PEHRWCDRRRDCPNASDELHCENHPNRRACSPFEFECGNSVCIPRKFICDGDNDCGDNSD
EINEHCKNAVCDPPLRFRCAHSRLCLNILQLCNGINDCGPFDHSDEHLSMCSSFSEYSDC
STNQFKCSNGKCINASLACDHNDDCGDASDEIGCAKRKGITCETNNENGNCKHLCTDVTN
GYYCHCRDGFQPNPDDPYDCIDIDECMGNNTCTQICLNTKGSYLCRCLEDYENNVVVGAM
TGKDCRAKGDPPLIMIAADGEVVQLNLAHAGETNRHAVGTLDQNDIIAVDFDPRRELMFW
IDRQQSKIYRSALPKGNQSHAGQELNIDFKNLKSSPSALSIDYLTGNIYIATIADEEAAG
FIARKKRNTEQSENENGRGTIYLAMSDGRYLRTVIKGRLQIPTAVITLPQIGRICFADAG
FEAKIECADMDGKHRDVIVKELVYSPTSLAVDEGKNNRIYWADPKYRKVESVLPDGTKRI
TVIVDNRLPWAVDVFENNLYWASKESRDLFVQDKFGRGRISILASNIPNVHNIRIHQRFA
RDTSRAISACSQAVCSHLCAELPLNTYTCLCPDESPQLDDGSCAGATVDELPIPKQCECQ
NGGICQLNGYCDCGDFEGEQCQKGSTVSRQLIGRFGSNALLAALLFVSLLICVAMMALVG
TNLYRKRLLLFKKNEAADGAVSFHGNVISFSNPVLDPKQVGSTFHFSSEQIVTSSTTFSN
PVYEMEESSDAQSMKSSSVIASSDSAIASRAHSFASVDMKPERSSSVIVAINFYFHFINL
SFISAPHSDLRPNIPSPPRRKLKERNDKTMLVSNDEVTDV
Download sequence
Identical sequences OVOC312

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]