SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC3665 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC3665
Domain Number 1 Region: 967-1017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000176
Family Laminin-type module 0.0091
Further Details:      
 
Domain Number 2 Region: 302-353
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000949
Family EGF-type module 0.08
Further Details:      
 
Domain Number 3 Region: 856-902
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000614
Family Laminin-type module 0.00087
Further Details:      
 
Domain Number 4 Region: 757-808
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000921
Family Laminin-type module 0.0087
Further Details:      
 
Domain Number 5 Region: 464-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000123
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 6 Region: 1015-1063
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.0067
Further Details:      
 
Domain Number 7 Region: 417-466
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000391
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 930-969
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000173
Family Laminin-type module 0.0045
Further Details:      
 
Domain Number 9 Region: 813-858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000176
Family Laminin-type module 0.0075
Further Details:      
 
Domain Number 10 Region: 361-419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000128
Family Laminin-type module 0.039
Further Details:      
 
Weak hits

Sequence:  OVOC3665
Domain Number - Region: 117-195
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00104
Family APC10-like 0.09
Further Details:      
 
Domain Number - Region: 719-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family EGF-type module 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OVOC3665
Sequence length 1654
Comment pep:known supercontig:Cameroon_v3:OVOC_OM1b:27309533:27328652:-1 gene:WBGene00240474 transcript:OVOC3665 description:""
Sequence
MHQHIVRILRRPCRTNLGILRLMYFLIWICQTVIAQPAEQIPSIDPHHYIPGSSPCYDDM
NIPQRCVPDFINAAFNLQVEVTNTCGLNGPISYCVQTGHSGVRKVCDICDSKVEAYAHPP
AYLTDFNNANNETWWQSETMNEGIQYPNSVNLTLNLGKTFDITYVRLKFISPRPESFVIF
KKTHPDDDWTPWQYYSGSCRSTYGIPEKAPILPSNEAVAQCTREFSDISPLTGGNIAFST
LEGRPSSQNFEESETLQDWVTASEIRIMLTRMNTFGDEVFRDAKVLRSYYYAISDFAVGG
RCKCNGHASECVKSTGDGEDRLVCRCEHNTMGADCDQCLPFYNDRPWRVGTAKEANECFA
CNCSHLSNRCYFDQVLFEQTGSGGHCIDCAGNTQGPHCEECAPFNWRRPGEHYCIPCQCN
EIGSLSMQCDDHGQCPCKPGVGGQFCDRCMDGYYDFSIRGCKDCLCDKTGSLNNEPVCDS
ETGSCRCKSNVEGQQCNKCKPGYFDLSLDNQFGCTPCFCYGHSSICSSADGYYAMNVSSN
FDDGKEYWIAGSMRGPEDIQWAEMDKAIAVSDIDGTPVYFVAPTQFTGDQRASYNQDLWF
TLRVQKAQVHPSARHVLFSIKDVIIVGQEGQELTIPIFAQENPMPSINEQTYHFRIHANP
VFQWSPRLNELDFIGILSNVSALKIRGTYSAGDVGFLSNVHLGSAGLTTPDDEPHEAHWI
ESCNCLEGFIGQFCESCAPGYRREIKFGGPFDRCVKCECHGHSTSCAPESGECICEHNTA
GDTCERCARGFYGNALQGTSDDCAKCPCPEDGPCVLHTDDDIICTDCPTGYTGRRCDVCA
DGFFGNPSEGKACVECSCSGNIDPNSIGNCDSLTGECKKCIYDTVGFSCEECKPGYWGDA
LLEPKGDCKACNCFVPGTKHPNKDYAVLECRQSDGQCNCQPHVIGLHCDHCQPGYFNLTS
GSGCQECNCDVLGSVNSTCDVLTGQCLCKSGVMGRRCDQCEPQHYGFGIDGCQPCDCEVI
GSESPQCDVITGQCLCRDHIEGRRCDHCTENRYNLQVGCLPCDDCYTLIQRRVHTFRKDI
GVLEETLKEIIENPAPVDDVEFDNYVKTVSAEVESLTDTVNKKLAGDDSQVIEQVNVIRS
DLKKALELLNSVDDIINKADRKANTIEETLNQWRLIKDRARSDLENALYYLETEGRTQWE
LAQEASRKYGEQSQQLSEIAQETRKLAEQQENRSIEIEALAEKIANSSKQALIEAQEVIF
GGDATSKEIAIMMERLNATEILLNQTGKLAEEQLLEADRAYKTAAESLTAVEGLRLPNID
PQQIEEEAKRVADDAQATADNAKEQAAANKELMDEAVRMIAEAKYELQRVQDQQKVSDEL
LADVDAAKARAVEAVSLAENTLAEAQHTLEILNDFEERVDASKSEAIEELRNLKEIEKEI
VLAEETTREAEDAIGNAKNDAQLAEKIALQAEKEAKSISKEAYELRNQTQDVRRTAEQLK
SSADQLVNDVKETGTTMEDYRRQASSDKARASEAVQKAQLAEKAAEGANKTISEAQDSLR
NIINQLNSLDGVNSEELDELEKQLNQAEELLNSADLDKQVSLLKEQKIEQDRTITQFKNE
IDTLKDEVQNLEEIRDSLPNKCFNVINLEQEGHK
Download sequence
Identical sequences A0A044SZK3
OVOC3665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]