SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC4402 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC4402
Domain Number 1 Region: 407-443
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000628
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 2 Region: 156-194
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000038
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 284-322
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000055
Family LDL receptor-like module 0.0024
Further Details:      
 
Domain Number 4 Region: 446-484
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 5 Region: 245-281
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000733
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 6 Region: 330-361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000903
Family LDL receptor-like module 0.0029
Further Details:      
 
Domain Number 7 Region: 490-525
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000589
Family LDL receptor-like module 0.0025
Further Details:      
 
Domain Number 8 Region: 215-240
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000864
Family LDL receptor-like module 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OVOC4402
Sequence length 584
Comment pep:known supercontig:Cameroon_v3:OVOC_OM2:4388112:4391767:1 gene:WBGene00241211 transcript:OVOC4402 description:""
Sequence
MSAHRSSYSPNNRVTSKKILSPLSIKSMADNSSQYHQRSDCVGGSLEIDRENQDRGCCLA
FLLKIENFKQYLAEISCCTWLNNIPLFAFLIGVTIFLVVLIILPFLTASLIIRSYLSTSQ
NDMHTIEIIRVQSNWPNADLSLQHRSFRSMIPPNITFCKGYGFSCTNLPSLVIGTLQRCD
GVEDCPDGSDETGCKLCHTTVNCSSVMTYGIISSRHSICLRGNRLCDGNIDCPDHSDEER
YCKKECSEHEVRCGETGICISHEQICDGDMQCKYGEDENSCDGICRAGALWCDEKKKCLP
KWQICDGIQNCPDGKDEMDCTCRECSGIGKALCNNTNVCIERSQVCDGNEDCPGGDDEVN
CPGSCPHSSEEEFIQCRNGIRYHRKYACSGLLNECEGKCDKCFEEMAFTCKNHKCIKRNL
VCDGLDDCGDNSDEANCNCTTMKRWRDTMQCMVQTRGQTTKCIPLSQRCDGYEDCPDGED
ERNCEGCINSNAIYCAPSKTCLLSTKRCDGVADCPDDNDEERCSCAECKMHGFPTYMCTN
AAKCFRRHEVCNPYTRCPNASEVDKLFCANQARQDTFLTAKKKL
Download sequence
Identical sequences A0A044TB93
OVOC4402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]