SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC5757 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC5757
Domain Number 1 Region: 69-235
Classification Level Classification E-value
Superfamily RUN domain-like 4.97e-25
Family RUN domain 0.00047
Further Details:      
 
Domain Number 2 Region: 532-600
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.00066
Further Details:      
 
Weak hits

Sequence:  OVOC5757
Domain Number - Region: 278-385
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0201
Family Myosin rod fragments 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) OVOC5757
Sequence length 610
Comment pep:known supercontig:Cameroon_v3:OVOC_OM2:13142881:13147684:1 gene:WBGene00242566 transcript:OVOC5757 description:""
Sequence
MNRFIIIQYFQVPAYWFCCCNLSTTMNVLELFGFDFSTTLTETQKLTKDYERSNLLFITR
LVLRVFLDESMRSRHRIIDIEIRSLTDLFVILEKILWHGFRSSVQKTMIALRTPDSELWS
CLGKVANINTDMNESYQCIDRLDKITTPLLRIRAFLRLAVMQKKLGNYFETLITSSHIRF
GNLLVLSYRNVSVYVFRDFYEPWALIRHDECIGLSGALMALSVLDCNLVLDQTELEKQPV
TVELAAYVHLPNISNHTNSEKESDLVNTRSLELALDQKNYLEQRNCYLESKMVELKTKME
EISLSALNNLSGATTEDVSMVTNEHIATVEALEKEKTELAQLASEKEDSIRILRQQLADT
KKVNVDLYEKIRVVEGKYRQLEKDMMSANKRYNHEREQQQQVINVLNERNSMREMDLEHE
TGTSEMLKKELADKTDEYMQTLNVLEKKQQELAVANDRLGKLQRQSSELNEKLKQLPVIK
QELEELTASYKYKSEKLEECEKALEELGGHLSESKLKVVELKEELLPLSEAEWEKDGNVL
NCKGCNLQFSMSKRKHHCRNCGSIFCNSCTDARVKLPSSAKPVRVCLHCYNLLRWRHNSS
LEENSSLNSF
Download sequence
Identical sequences A0A044TX69
OVOC5757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]