SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC678 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC678
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-21
Family SH2 domain 0.0013
Further Details:      
 
Domain Number 2 Region: 117-155
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000628
Family SOCS box-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) OVOC678
Sequence length 176
Comment pep:known supercontig:Cameroon_v3:OVOC_OM1b:4788336:4790063:1 gene:WBGene00237487 transcript:OVOC678 description:""
Sequence
MMLQVILSWYWGNMSWRDAEKVLMNQLPGTYLVRDSASDRYIFTISYRTKHSVHHTRLAQ
HGGNFCLGANSLVSFIENSLQSCGKRRICMLMHPKSDSTGIEILELNHLLHRHELLPSLK
YLCRVVIRNCVEKELLACLPLPPNMIYYLKDPKYFVPSCVHQEIPVNNSLGYLRNK
Download sequence
Identical sequences OVOC678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]