SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC8413 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC8413
Domain Number 1 Region: 265-404
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 6.15e-58
Family P-domain of calnexin/calreticulin 0.000000841
Further Details:      
 
Domain Number 2 Region: 75-267
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.59e-56
Family Calnexin/calreticulin 0.00000174
Further Details:      
 
Weak hits

Sequence:  OVOC8413
Domain Number - Region: 384-450
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0116
Family Calnexin/calreticulin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OVOC8413
Sequence length 597
Comment pep:known supercontig:Cameroon_v3:OVOC_OM3:7066891:7071797:1 gene:WBGene00245222 transcript:OVOC8413 description:""
Sequence
MWRYWWLCFMLAGLLFATCTAHDENDNSDNDFDEKNVLDEEEKSEKFEYIPPPFQTPAIP
GSPLLVDWFSNRNAIGRKWFISKGKKDNVEDSIAKFNGQWEIGTPSAVVIDNDFGLIVKT
RARHHAIAAKFNRPFKFDGKPLVVQYEVKYEEGQECGGGYMKLLTEGIEVLEEFTDKTPY
TILFGPDKCGAKSSILFIVRFRNPKNGTISEHHAKQPSKSVSTYFDDHKTHLYTLIVRPD
ETFTVLVDEIKIMSGSLITDLEPSITPPTVIDDPTDKKPENWDEREKIDDPDAKKPDDWD
EHAPRKIEDANAVMPDDWLEEEEPLIPDSDATKPSDWDDSMDGEWEAPKIDNPKCKDRSG
CGKWTRPMIDNPNYKGKWKSPRIANPNYKGKWKPKQIENPNYFEPHPYSQLQPITACGIE
LWTMSANIIFDNIYIGDDENAASSFAEQTFKIKRAQEAAYENASSPGQGILSKLVSATEE
RPWLWVIYILSILIPVIIIAVICFGRKSRPVTPDYKKTDESHPDDEVPDLVGDDDESTER
SSQEPEAHDDNAKEKKRTPSGSPSRSRIEKEASSGEEITNGNNNSPKVRRIRQRKQD
Download sequence
Identical sequences A0A2K6WI12
OVOC8413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]