SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC8444 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC8444
Domain Number 1 Region: 1630-1770
Classification Level Classification E-value
Superfamily SET domain 6.15e-46
Family Histone lysine methyltransferases 0.0032
Further Details:      
 
Domain Number 2 Region: 87-183
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000471
Family Canonical RBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OVOC8444
Sequence length 1773
Comment pep:known supercontig:Cameroon_v3:OVOC_OM3:7284879:7302454:-1 gene:WBGene00245253 transcript:OVOC8444 description:""
Sequence
MPCVVSGYIGSVVRLGSGGKVSVGGSNRSRPASETVHHFHHKLAWKAINIDAKHVIFRCD
GICKDNPKYNVHTLGDPRNPLTRFRNVESIDLPLPSFVLDNNSVGPQPKREVSIFGLNDN
INHAFLSNMCQKTGQIIEVFVYMHPRTKKHLGMAYVVFQDVGKAQSFVTKNNGTSVMGQT
ITCIIDPYAKEISRLYEKQAMEAAPVPRYLSRLDHNRLTEFRKINSPSISEHKNIYTSPS
PSTSGQQSTDFKILEPAPQKQPDESETAFHHDKGRQIHQQSVDATLTKTAHIENVVPPNE
RSTIPSITEHFPLSTVSSSSTNLSYPSLATHQTFCSHHLMSHQHSQAPFTYYHSMPSNPI
SPLPSFPPISSSVSTFSPLPPLPPITGRMPFPIWSNVPLPPLRTSVPNIWPRAKTIVSAS
VPSQVLSIKSSVPTISNFASTAYQPVPSTSSFEETAPMDPAPSKQENKEKKKLKTIIPGE
QKRKRSIPASGKVKVRKRKRLREFVSVSSASESSNSKSDERSELSEESSQSSSSTVKRKL
RHRKKGIVEERKYYKKKGAGGTSNYYREIVIRKNDNIRKCSHETKSDLLQSPELVEEVES
YQRIRKYKKQEQETTKRDEHFVEPDVDLPDLESVSSEEDQFSAQGQELKVQSAAKKSKSH
SKILSMKHTRQQQSRHVNWRKKRIMEKRHKQCDNGSYRDRESSSLSGNEKGHRWSSSSST
VESEMESDEPSSFGNNKRYGIDFSGRTGNKKLVDPYVGTCKHPSNLHSLKNLQMVNLSDI
VEAVTASSEESDDEAVGTSDIVHQPIAHVKNNLTKNESTQSLPTPTLITSPEKPSGDSPL
PCVLQSTPPTESSRSSFERRLENLFRSTSMQPPIIEIHEEERSNDAGSISLPFISVLDVP
FLPSTTATSAVVRQEMPLSEASFAERSNAEITVVKHPFDLNSTESWTNSQAQIEANSICR
NTTLDPIGASSPVNAVNKVREENKHLSTIMEEQSELTEDKEVEIGDGLKENKKRKELEEQ
ILEKKRAARENYVHAVYVAVREELKTVLLKDLMRKIEIVAFEKLEKGWKEKEKAKVEEQD
DDFWQNEAKDGVTDTPIPTIDKASVLSVKQTVSSKDSLNEMVRQVTEQTRAEMSAAFGPD
TAALLGTGLFFKGLGIARNMPSFKKPKCDYFQKQVHLSPKRKQRSRSRNSYKSFCSASSS
TKSGRTTESSRSYRRSENQNRSRSESSLVEERSSDEDTKSENERSISGSESICSTDLSSQ
VLSIRKHDGSGIVTPTDGSMSEEDEDEEEEVDKEEEEQQEEQEHIGKDFNEIRAIGIEEK
AMLFVKAEIGENNGCDETESLSSSTAASHLIEQNKITEELRTRNKKVHDTANIEGYFNDH
CYLPVELSEQLKKEFEESISACSDSETISAEFSETIKSEKSEKTLLQHVQDKTVKVKKRC
YRNELASLLPPPVDVEQLTWETAWKPAKQWDKRTHKEEEEIFWKFEKEGLDAEDLMFLEK
AFHEMQNDGTATWNRKLYWVPPRKVPEIHLLDKPKKIGKNIYYYDDPELEGVIPHSSGCA
RTEGYYKLSHKEKRGVLRRPDVFLTEINEKDDEKARYMMQSTREARSMNRRLLTSMGDTS
SDIFKVNQLKFRKKLIKFARSRIHGWGLYALEAIVPDEMIVEYIGQKIRPTVADEREKRY
ERRGMGSSYLFRIDSDNVIDATQMGNLARFINHSCQPNCYAKIVVVDGEKRIVIYSKLPI
NKGDEITYDYKFPIEEDKIDCLCGAPGCRGSLN
Download sequence
Identical sequences OVOC8444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]