SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for OVOC9874 from Onchocerca volvulus 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  OVOC9874
Domain Number 1 Region: 22-63,135-199
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.58e-25
Family Voltage-gated potassium channels 0.004
Further Details:      
 
Domain Number 2 Region: 402-587
Classification Level Classification E-value
Superfamily Fibronectin type III 4.82e-25
Family Fibronectin type III 0.0028
Further Details:      
 
Domain Number 3 Region: 241-340
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.27e-18
Family Voltage-gated potassium channels 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) OVOC9874
Sequence length 618
Comment pep:known supercontig:Cameroon_v3:OVOC_OM4:1576150:1581898:1 gene:WBGene00246683 transcript:OVOC9874 description:""
Sequence
MPRWLHQCQCKFTNQLAIMSLLRILRRLIIAKLFSPHFILTIVCILYMIIGAWIFQILEG
RHLKDMKAAQLNRIDVSVEKYVDRIWNLARSEKYQKLSKSKLKDAFRRDSKEHFYQYVDT
VFTAHRKYRHGYDKDAPSWDFITSFFFTATMLTSIGYGYVAPSTFSGRLFGVIYCLIGIP
LTLVTVANIAKFISECAFLIHYKCWKKFVEWNDRRKGFIHHGTIFDDDENEQELLDKIKL
VRFPPVILFLLVFFYGLFGSYIIQKKEHWSYTESVYFTFISILTVGFGDYRPEQQNMMVV
LCVIMGGIILTTMCMDVVGRMYLKEIHYIGRKIQTNNPFFLIREAKARRRRQATASLLLD
LARGMIFDHKGEPMAIRRMSRRLQKRGAHMLPDDEFMFARLPPDPPRECQVVSTSAYSVR
LAWAPAFSADDEVTYNIRYRIKHQENSKARELRGIQGHSAEIMSVDSCSLYEFRITAVSR
YGESKPVYLVQYTEPQLSPQHILARRLNANTIELSWEPPYKRTRDVTSYIVYYTENPNAH
FSAWERITVRGRRIVFPDLRYDWFYMFCATACFKDGQRSPLSRALFVKTDKLEFRPKCSN
IYNFLEISTHYLKKYFSH
Download sequence
Identical sequences A0A044VHP8
OVOC9874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]