SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR037C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR037C
Domain Number 1 Region: 112-275
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.79e-50
Family Glutathione peroxidase-like 0.0000000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YBR037C
Sequence length 295
Comment SCO1 ORF Verified Copper-binding protein of the mitochondrial inner membrane, required for cytochrome c oxidase activity and respiration; may function to deliver copper to cytochrome c oxidase; has similarity to thioredoxins
Sequence
MLKLSRSANLRLVQLPAARLSGNGAKLLTQRGFFTVTRLWQSNGKKPLSRVPVGGTPIKD
NGKVREGSIEFSTGKAIXLFLAVGGALSYFFNREKRRLETQKEAEANRGYGKPSLGGPFH
LEDMYGNEFTEKNLLGKFSIIYFGFSNCPDICPDELDKLGLWLNTLSSKYGITLQPLFIT
CDPARDSPAVLKEYLSDFHPSILGLTGTFDEVKNACKKYRVYFSTPXNVKPGQDYLVDHS
IFFYLMDPEGQFVDALGRNYDEKTGVDKIVEHVKSYVPAEQRAKQKEXWYSFLFK
Download sequence
Identical sequences YBR037C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]