SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCL035C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL035C
Domain Number 1 Region: 3-51
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000314
Family Thioltransferase 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YCL035C
Sequence length 55
Comment GRX1 ORF Verified Hydroperoxide and superoxide-radical responsive heat-stable glutathione-dependent disulfide oxidoreductase with active site cysteine pair; protects cells from oxidative damage
Sequence
MKEXADIQAALYEINGQRTVPNIYINGKHIGGNDDLQELRETGELEELLEPILAN
Download sequence
Identical sequences YCL035C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]