SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCL043C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCL043C
Domain Number 1 Region: 232-364
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.4e-31
Family PDI-like 0.000000791
Further Details:      
 
Domain Number 2 Region: 8-105
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.59e-30
Family PDI-like 0.00000254
Further Details:      
 
Domain Number 3 Region: 106-229
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.12e-25
Family PDI-like 0.000000593
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YCL043C
Sequence length 388
Comment PDI1 ORF Verified Protein disulfide isomerase, multifunctional protein resident in the endoplasmic reticulum lumen, essential for the formation of disulfide bonds in secretory and cell-surface proteins, unscrambles non-native disulfide bonds
Sequence
MIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNATFYSMANKHFNDYDFVSAE
NADDDFKLSIYLPSAMDEPVVYNGKKADIADADVFEKWLQVEALPYFGEIDGSVFAQYVE
SGLPLGYLFYNDEEELEEYKPLFTELAKKNRGLMNFVSIDARKFGRHAGNLNMKEQFPLF
AIHDMTEDLKYGLPQLSEEAFDELSDKIVLESKAIESLVKDFLKGDASPIVKSQEIFENQ
DSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAK
LDHTENDVRGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFDVDGKALY
EEAQEKAAEEADADAELADEEDAIHDEL
Download sequence
Identical sequences YCL043C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]