SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL010W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL010W
Domain Number 1 Region: 126-213
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.47e-19
Family Thioltransferase 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDL010W
Sequence length 231
Comment GRX6 ORF Verified Cis-golgi localized monothiol glutaredoxin that binds an iron-sulfur cluster; more similar in activity to dithiol than other monothiol glutaredoxins; involved in the oxidative stress response; functional overlap with GRX7
Sequence
MIPSNKRNARILSXTTLLLLLVFFVAQNANFLTVEIKEETSKAFSTNMDNMAAGSSREYA
AMPTSTTNKXSSEVDEEINEIKQKVGLQQPIASVDDSLSAIKNDKGSRITKAFNVQKEYS
LILDLSPIIIFSKSTCSYSKGMKELLENEYQFIPNYYIIELDKHGHGEELQEYIKLVTGR
GTVPNLLVNGVSRGGNEEIKKLHTQGKLLESLQVWSDGKFSVEQREKPSNN
Download sequence
Identical sequences E7NGL9
YDL010W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]