SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR183W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR183W
Domain Number 1 Region: 25-198
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.4e-33
Family Thioltransferase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDR183W
Sequence length 230
Comment PLP1 ORF Verified Protein that interacts with CCT (chaperonin containing TCP-1) complex and has a role in actin and tubulin folding; has weak similarity to phosducins, which are G-protein regulators
Sequence
MEDKLDRYYTNVLSNAEKDKHTTVDSDDKSSGEENLDELLNELDRELDEDHEFLSAYRSE
RLQQISDHLKQVKKNVEDDGYGRLQCIDNEADAIQICTKTTMVVIHFELETFGKCQYMNE
KLENLAKRYLTTRFIKVNVQTCPFLVNKLNIKVLPFVVGYKNGLEKVRYVGFSKLGNDPN
GFDIRRLEQSLAHSGVIEDAFEIRKHSSVNTERFASTNHDRSESDSDLDI
Download sequence
Identical sequences E7NFU2
YDR183W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]