SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR286C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR286C
Domain Number 1 Region: 15-66
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000234
Family Thioltransferase 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR286C
Sequence length 108
Comment ORF Uncharacterized Putative protein of unknown function; predicted to have thiol-disulfide oxidoreductase active site
Sequence
MLRAFRCSIHTSRVLLHDAGVKLTFFSKPNCGLCDQAKEVIDDVFERKEFHNKAVSLEIV
NITDRRNDKIGGRNIASTYQYFILRKLVILSRAPRSCTFLKKTISVIK
Download sequence
Identical sequences YDR286C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]