SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YFR016C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YFR016C
Domain Number 1 Region: 185-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000134
Family SH3BGR (SH3-binding, glutamic acid-rich protein-like) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YFR016C
Sequence length 283
Comment ORF Verified Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the cytoplasm and bud; interacts with Spa2p; YFL016C is not an essential gene
Sequence
MKNSKIAEALKDVTGDQEIDDINISDEFQRTVELPELEKQDIKDNKGEDKELEVEETEKE
TSLPDLVVEENITEEKNEIKQEEEEVSQLDFNETESISKEAPNNDENGFEDQSTRENPKK
ASADDIFKDILDETNEFLEQLKIVDDSELNALLQSLDAKDSTTQTTEQSKKNNDKPQDVI
TTSEIRKLNEKEXVYIYTSLAGGGFHMIPRTNRLITILTANRIPFTYRDLGTDDEARKVW
KTFSKGRSLPGVVRGHNDLIGNWEEIEEANEDYKLRELIYDTI
Download sequence
Identical sequences YFR016C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]