SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YGR201C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YGR201C
Domain Number 1 Region: 83-221
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 4.23e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0000947
Further Details:      
 
Weak hits

Sequence:  YGR201C
Domain Number - Region: 17-78
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.012
Family Glutathione S-transferase (GST), N-terminal domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YGR201C
Sequence length 225
Comment ORF Uncharacterized Putative protein of unknown function
Sequence
MSDGTLFTDLKERKLIRTIVPRGLVRSLKLDVKLADPSDAQQLYEKEFPLRKYPTFVGPH
DEWTLTEAMAXDYYLIHLSSDKEAVRQLLGPEGDFKTRADILRWESLSNSDFLNEVCEVF
FPLIGVKPYNATEFKXXRENVDTIVSLYEKRLKKQQYLVCDDHETLADLISAAAFSLGFI
SFFDETWRSKHPEVTRWFNRVIKSRFFEGEFESFKMCETEMQPIK
Download sequence
Identical sequences YGR201C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]