SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIL005W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YIL005W
Domain Number - Region: 97-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000162
Family Thioltransferase 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YIL005W
Sequence length 263
Comment EPS1 ORF Verified ER protein with chaperone and co-chaperone activity, involved in retention of resident ER proteins; has a role in recognizing proteins targeted for ER-associated degradation (ERAD), member of the protein disulfide isomerase family
Sequence
MKNXEYFPEIRLYNPSGYIKSFTETPRTKESLIAFARRESMDPNNLDTDLDSAXSESQYL
EGFDFLELIAGKATRPHLVSFWPTKDMKNSDDSLEFKNCDKCHEFQRTWKIISRQLAVDD
INTGHVNCESNPTICEELGFGDLVKITXHRADREPKVALVLPNKTSNNLFDYPXGYSAKS
DGYVDFARRTFTNSKFPNITEXELEKKANRDIDFLQERGRVTNNDIHLVFSYDPETVVIE
DFDILEYLIEPLSKNSKXIFAPN
Download sequence
Identical sequences YIL005W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]