SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YIR037W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YIR037W
Domain Number 1 Region: 4-160
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.06e-60
Family Glutathione peroxidase-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YIR037W
Sequence length 163
Comment HYR1 ORF Verified Thiol peroxidase that functions as a hydroperoxide receptor to sense intracellular hydroperoxide levels and transduce a redox signal to the Yap1p transcription factor
Sequence
MSEFYKLXPVDKKGQPFPFDXLKGKVVLIVNVASKCGFTPQYKELEALYKRYKDEGFTII
GFPCNQFGHQEPGSDEEIAQFCQLNYGVTFPIMKKIDVNGGNEDPVYKFLKSQKSGMLGL
RGIKWNFEKFLVDKKGKVYERYXSLTKXSSLSETIEELLKEVE
Download sequence
Identical sequences YIR037W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]