SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YKR049C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKR049C
Domain Number 1 Region: 1-131
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.21e-41
Family YKR049C-like 0.000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YKR049C
Sequence length 133
Comment FMP46 ORF Verified Putative redox protein containing a thioredoxin fold; the authentic, non-tagged protein is detected in highly purified mitochondria in high-throughput studies
Sequence
MSFWKTLQRQPRTISLFTNDIASNIKSQKCLQXLKGDVSHRFDVEIANRFPTWDQLQYMR
TSCPQGPVSLQRQIPKLDSVLKYKHTDPTFGMDLQKCVQRGLWNPKEALWVDWENKLVGN
EPADIDKYIIQRK
Download sequence
Identical sequences YKR049C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]