SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLL060C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLL060C
Domain Number 1 Region: 58-186
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 1.5e-24
Family Glutathione S-transferase (GST), C-terminal domain 0.0069
Further Details:      
 
Domain Number 2 Region: 5-68
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000000247
Family Glutathione S-transferase (GST), N-terminal domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YLL060C
Sequence length 192
Comment GTT2 ORF Verified Glutathione S-transferase capable of homodimerization; functional overlap with Gtt2p, Grx1p, and Grx2p
Sequence
MLSSVQFVRINLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEYIDALDGTPT
LTGKTPLEKGVIHMMNKRAELELLDPVXVYFHHATPGLGPEVEXYQNKEWXLRQRDKALH
GMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIXKLQVPEECEALRAWYKRMQQRPS
VKKLLEIRSKSS
Download sequence
Identical sequences YLL060C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]