SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YLR109W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YLR109W
Domain Number 1 Region: 37-174
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.41e-22
Family Glutathione peroxidase-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YLR109W
Sequence length 176
Comment AHP1 ORF Verified Thiol-specific peroxiredoxin, reduces hydroperoxides to protect against oxidative damage; function in vivo requires covalent conjugation to Urm1p
Sequence
MSDLVNKKFPAGDYKFQYIAISQSDADSESCKMPQTVEWSKLISENKKVIITGAPAAFSP
TCTVSHIPGYINYLDELVKEKEVDQVIVVTVDNPFANQAWAKSLGVKDTTHIKFASDPGC
AFTKSIGFELAVGDGVYWSGRWAMVVENGIVTYAAKETNPGTDVTVSSVESVLAHL
Download sequence
Identical sequences A0A0L8VKR5 A0A250WM37 A7A113 B3LT76 B5VN47 C7GQT1 C8ZD80 E7KFI7 E7KRN6 E7LXK2 E7NKF2 E7QHX1 G2WIV3 H0GK73 N1NZ91 P38013
YLR109W YLR109W YLR109W YLR109W YLR109W YLR109W SCRT_05094 YLR109W YLR109W YLR109W YLR109W YLR109W NP_013210.1.97178 YLR109W YLR109W 4932.YLR109W YLR109W YLR109W YLR109W YLR109W YLR109W YLR109W YLR109W YLR109W tr|A7A113|A7A113_YEAS7 YLR109W YLR109W YLR109W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]