SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML013W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YML013W
Domain Number - Region: 14-60
Classification Level Classification E-value
Superfamily UBA-like 0.00128
Family TAP-C domain-like 0.031
Further Details:      
 
Domain Number - Region: 219-353
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0208
Family Thioltransferase 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YML013W
Sequence length 388
Comment UBX2 ORF Verified Protein involved in ER-associated protein degradation; proposed to coordinate the assembly of proteins involved in ERAD; contains a UBX (ubiquitin regulatory X) domain and a ubiquitin-associated (UBA) domain
Sequence
MPVVNHEDSEFHLSHTEEDKLNEFQVITNFPPEDLPDVVRLLRNHGWQLEPALSRYFDGE
WKGEPDQMGESTQTSTPMAETLVPPALGPRPLLFTASLPVVRPLPANFRNDFRTIXLNGR
SNTVWSMFESFSYDGNPFLFILLLIPRIINRLSATIFTFFCTLLSLHSISGGGNSGKPKI
SKVPKAPTRETHIPLAEILGDTKDKDAFCELKSFKPDISFNEALRIAKEEFKFMLLILVG
DTYDTDTDTVDXNSKLLLEKILLNKKTLQYLRKIDNDLIIYLKCVXELEPWLVARQLGVR
NTPEIFLIANVANKASHSETLPSQRLSILGKLKVNSLNRFLQSLTNVVEKYTPELVVNKT
EMHELRMSREIKKLAGGCVQKVARNGQN
Download sequence
Identical sequences YML013W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]