SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YML028W from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YML028W
Domain Number 1 Region: 4-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.73e-62
Family Glutathione peroxidase-like 0.00000047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YML028W
Sequence length 196
Comment TSA1 ORF Verified Thioredoxin peroxidase, acts as both a ribosome-associated and free cytoplasmic antioxidant; self-associates to form a high-molecular weight chaperone complex under oxidative stress; deletion results in mutator phenotype
Sequence
MVAQVQKQAPTFKKTAVVDGVFDEVSLDKYKGKYVVLAFIPLAFTFVCPTEIIAFSEAAK
KFEEQGAQVLFASTDSEYSLLAXTNIPRKEGGLGPINIPLLADTNHSLSRDYGVLIEEEG
VALRGLFIIDPKGVIRHITINDLPVGRNVDEALRLVEAFQWTDKNGTVLPCNWTPGAATI
KPTVEDSKEYFEAANK
Download sequence
Identical sequences E7NLB3 E7Q7K0
YML028W YML028W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]