SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YNL229C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL229C
Domain Number 1 Region: 201-351
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.42e-28
Family Glutathione S-transferase (GST), C-terminal domain 0.00000006
Further Details:      
 
Domain Number 2 Region: 103-196
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.06e-23
Family Glutathione S-transferase (GST), N-terminal domain 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YNL229C
Sequence length 354
Comment URE2 ORF Verified Nitrogen catabolite repression transcriptional regulator that acts by inhibition of GLN3 transcription in good nitrogen source; has glutathione peroxidase activity and can mutate to acquire GST activity; altered form creates [URE3] prion
Sequence
MMNNNGNQVSNLSNALRQVNIGSRNSNTTTDQSNINFEFSTGVNNNNNNNSSSNNNNVQN
NNSGRNGSQNNDNENNIKNTLEQHRQQQQAFSDMSHVEYSRITKFFQEQPLEGYTLFSHR
SAPNGFKVAIVLSELGFHYNTIFLDFNLGEHRAPEFVSVNPNARVPALIDHGMDNLSIWE
SGAILLHLVNKYYKETGXPLLWSDDLADQSQINAWLFFQTSGHAPMIGQALHFRYFHSQK
IASAVERYTDEVRRVYGVVXMALAERREALVMELDTENAAAYSAGTTPMSQSRFFDYPVW
LVGDKLTIADLAFVPWNNVVDRIGINIKIEFPEVYKWTKHMMRRPAVIKALRGE
Download sequence
Identical sequences YNL229C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]