SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YOR281C from Saccharomyces cerevisiae FostersO

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YOR281C
Domain Number 1 Region: 17-227
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.03e-38
Family Phosducin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YOR281C
Sequence length 286
Comment PLP2 ORF Verified Essential protein that interacts with the CCT (chaperonin containing TCP-1) complex to stimulate actin folding; has similarity to phosducins; null mutant lethality is complemented by mouse phosducin-like protein MgcPhLP
Sequence
MQNEPMFQVQVDESEDSEWNDILRAKGVIPERAPSPTAKLEEALEEAIAKQHENRLEDKD
LSDLEELEDDEDEDFLEAYKIKRLNEIRKLQERSKFGEVFHINKPEYNKEVTLASQGKKY
EGAQTNDNGEEDDGGVYVFVHLSLQSKLQSRILSHLFQSAACKFREIKFVEIPANRAIEN
YPESNCPTLIVYYRGEVIKNMITLLELGGNNSKMEDFEDFMVKVGAVAEGDNRLIMNRDD
EESREERKLHYGEKKSIRSGIRGKFNVGIGGNDDGNINDDDDGFFD
Download sequence
Identical sequences A0A250WAB1 C7GWB0 E7NMP7 E7Q9F8 G2WNE8 N1P3N0 Q12017
YOR281C YOR281C NP_014924.3.97178 YOR281C YOR281C YOR281C YOR281C YOR281C YOR281C YOR281C YOR281C 4932.YOR281C YOR281C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]