SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Hypbu1|153223|fgenesh1_kg.5_#_21_#_Locus3069v1rpkm37.36 from Hyphopichia burtonii NRRL Y-1933 v1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Hypbu1|153223|fgenesh1_kg.5_#_21_#_Locus3069v1rpkm37.36
Domain Number 1 Region: 97-324
Classification Level Classification E-value
Superfamily Sec7 domain 9.81e-65
Family Sec7 domain 0.000000949
Further Details:      
 
Domain Number 2 Region: 333-447,499-618,664-773,827-962
Classification Level Classification E-value
Superfamily ARM repeat 0.0000163
Family Clathrin heavy-chain linker domain 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Hypbu1|153223|fgenesh1_kg.5_#_21_#_Locus3069v1rpkm37.36
Sequence length 1058
Sequence
MLIESLSLLWTRSPIFFTNLFIDYDCDFDRSDLAITALDFLCKLSLPESALYTTDNVPPI
CLEGVLSFIGGINDRIKLLSAQKDSGDIDTHLLIMDKNQKTSFVKSTEIMNKNPKEGIKE
LAKRGFITDEKDVKELAKFFFTKSVRLNKKILGEFLTKQSNAELLKEFINLFEFSDLRVD
EALRILLKAFRLPGESQQIERVVELFAERYVNCQHPAEESDKISQKKEDEANEDEKAKEE
EEAAAEEEELEPVRPDADAVFILSYSVIMLNTDLHNPQVKSHMTLDSYKKNLRGIYYGKD
FPTWYLSKIYYSIRDREIIMPEEHHGTDKWFDDAWHNLISSQASVIGSEANSDYNQKQFG
IGHICQFDRVLFESIVDRLIDTLISVFKEATDDHVITRLMSSIDKCANICIYYNLSSSVD
KLIGLLADLTSLTNTTESPIISDDGPRDEIPITQIKIENKEDAITVSEMAVWFGRDFKAQ
LSTVVLFRLIKKTDCKVTDSWDKVLKIILNLFENCLINPNLFSDFQKKVKLNPLPKVKPR
YIINRSKAMKDSGILSTFSSFLKGYSDEPPEPSDQEVESTLSAIDCVRSVNVPSIFENIS
RGSPTDLKLFLQKLLKSLPEFSDKSKRYFETETLFIYEVAVCFCLLLKDFETTSLVANSI
ASALNVSEISKKTMLRLSAYLFITLRHGEETKDDVAQKVLRSLVLQDKELSSKHGAQLVQ
PLISLVDDDSPYCKVLLNNDDYWKLMRTFGSNPTHAHEILPFVDGIIKSSPNDITPTNYM
LILGLLDEVSSLGAIGSQWEQESEQLAGSGQKVPESADNVYFKDLVEISKKSIGLTSELA
SVVTRKDFEGKELSYSLVQALAHQCFNPCREIRSFAIKTLQATVLSTEISDEFTAFGIFE
YGLFPLLTELSKHDVLQTDIKGFMSTQFEALSLISRVFLNYHTKFVEQQTDRAWLTILDN
FIIFNDLGEKYNKSNNLIKESGIELVKNMVLVLQNGKILTEENNDLWNSSWEKIDTLYPS
LKNEIAGSNDKGPVEDNTTKSDKGEKEQTVEPEETEVD
Download sequence
Identical sequences A0A1E4RGG3
XP_020075373.1.17418 jgi|Hypbu1|153223|fgenesh1_kg.5_#_21_#_Locus3069v1rpkm37.36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]