SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YAR023C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YAR023C
Domain Number - Region: 113-155
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0299
Family Interferon regulatory factor 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YAR023C
Sequence length 179
Comment ORF Uncharacterized Putative integral membrane protein, member of DUP240 gene family
Sequence
MINFLLFVVTILATLTDIWFSGVLSPAMVIRICLGGSMVVLQIWSFSRPISNETFRTKLL
LEVITHRPSIAGKEWKTITYNMNQYLFKAGLWKTPYHFFCEHQCYEFFKDLIKGKYPDVQ
WDTANTQPFISVPENQAATQNPDVEPTVKWCLFKAAEIQAHAVREYWQSQYPDVGIPAI
Download sequence
Identical sequences B3LUS9 C7GST1
YAR023C YAR023C YAR023C YAR023C YAR023C YAR023C YAR023C YAR023C SCRT_05626

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]