SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR055C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR055C
Domain Number 1 Region: 299-771
Classification Level Classification E-value
Superfamily TPR-like 2.66e-28
Family HAT/Suf repeat 0.047
Further Details:      
 
Domain Number 2 Region: 732-870
Classification Level Classification E-value
Superfamily TPR-like 0.000000000161
Family Tetratricopeptide repeat (TPR) 0.06
Further Details:      
 
Domain Number 3 Region: 219-294
Classification Level Classification E-value
Superfamily TPR-like 0.0000322
Family HAT/Suf repeat 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR055C
Sequence length 899
Comment PRP6 ORF Verified Splicing factor, component of the U4/U6-U5 snRNP complex
Sequence
MERPSFLNQEPPAGYVPGIGRGAIGFSTKEKQVVSNDDKGRRIPKRYRENLNNHLQSQPK
DDEDDEAANVFKTLELKLAQKKKKRANEKDDDNSVDSSNVKRQFADLKESLAAVTESEWM
DIPDATDFTRRNKRNRIQEQLNRKTYAAPDSLIPGNVDLNKLTEEREKLLQSQIDENLAQ
LTKNASNPIKVNKPNAATDALSYLKDLENDRVNSLSDATLEDLQKMRTILKSYRKADPTN
PQGWIASARLEEKARKFSVAKKIIENGCQECPRSSDIWLENIRLHESDIHYCKKLVATAI
NFNPTSPLLWFKAIDLESTTVNKYRVVRKALQEIPRDEGLWKLAVSFEADKAQVIKMLEK
ATQFIPQSMDLLTAYTNLQSYHNAKMTLNSFRKILPQEPEIWIISTRLEERNNPDIPVDK
LVSLLKEGLLELSKNGYKATLSAWLKRAEALNDAPNSNLTCQAIVYAILEWLRESGEYES
ELNNVDQILEKKPHSKVQIAVLKKLIQWDPCDTVLWSRLKMATESYHKIEELLAFFQELL
FQTKNSDDIRANMREKSPGLLMMYLSEYWKAQKGDTRQTLVLIDQIIDFAPHNLDLRFFK
IKLLGRSLQLDELRDFFQQTFSSLEDFKISGTERLYYKYVNFLRYQDLNEEAIKFLNERC
LKSFPICHKFFLQLGQIYHSMGNIEMSRETYLSGTGLVPNCPLLWVSLSKIDEIDLKNPV
RARSILDRGLLKNPDDVLFYIAKIQMEIRLGNLDQAELLVTQALQKFPSNALLWVEQIKL
FKHGNKSSLKKTIFQDALRRTQNDHRVLLEIGVSFYAEAQYETSLKWLERALKKCSRYGD
TWVWLFRTYARLGKDTVDLYNMFDQCEPTYGPEWIAASKNVKMQYCTPREILLRLMNDK
Download sequence
Identical sequences C7GSU1
YBR055C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]