SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR066C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR066C
Domain Number 1 Region: 162-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000103
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YBR066C
Sequence length 220
Comment NRG2 ORF Verified Transcriptional repressor that mediates glucose repression and negatively regulates filamentous growth; has similarity to Nrg1p
Sequence
MSIGYKDNLMSTILAKDRKCEFPINFECSPSQITLMPEMFSFNNERKYQTLIPLIKTSHL
IDDDLKDKLNKCAFDFFSGKQANRTSDGTISRLTASGKTSPILPLQNINIVKAENTGNGK
SDPYSSIKISKPTKTVIKLKSTKTNTAGQRTRHFCKICSTGFTTSGHLSRHNRIHTGEKN
HICPHEGCGQRFSRHDNCNQHYRTHANKKKRNWKRRETSS
Download sequence
Identical sequences C7GQI1
YBR066C YBR066C YBR066C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]