SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YBR267W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YBR267W
Domain Number 1 Region: 162-252
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000506
Family Classic zinc finger, C2H2 0.053
Further Details:      
 
Weak hits

Sequence:  YBR267W
Domain Number - Region: 5-37
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0227
Family Classic zinc finger, C2H2 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YBR267W
Sequence length 393
Comment REI1 ORF Verified Cytoplasmic pre-60S factor; required for the correct recycling of shuttling factors Alb1, Arx1 and Tif6 at the end of the ribosomal large subunit biogenesis; involved in bud growth in the mitotic signaling network
Sequence
MSSSGVYTCNSCVLTFDASDEQRAHMKSDWHRYNLKRRVAQLPPISFETFDSKVSAAAAS
TSKSAEKEKPVTKKELKRREKQALLEKKKKLLEIARANMLENMQKSQEGNTPDLSKLSLQ
ENEENKEKEEPKKEEPEQLTEEEMAERVMQEKLRNRVDIPLEQCLFCEHNKHFKDVEENL
EHMFRTHGFYIPEQKYLVDKIGLVKYMSEKIGLGNICIVCNYQGRTLTAVRQHMLAKRHC
KIPYESEDERLEISEFYDFTSSYANFNSNTTPDNEDDWEDVGSDEAGSDDEDLPQEYLYN
DGIELHLPTGIKVGHRSLQRYYKQDLKPEVILTEGQGTLVAAETRSFLPAFDKKGVQTQQ
RVWQTERFDKKRLDKRSAKFVNNQPHYRDQLLQ
Download sequence
Identical sequences B3LMP5 C7GMW4 D3UF14 E7K9L3
YBR267W YBR267W YBR267W SCRT_02703 YBR267W YBR267W YBR267W YBR267W YBR267W YBR267W YBR267W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]