SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YCR087C-A from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YCR087C-A
Domain Number 1 Region: 29-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000147
Family C2HC finger 0.013
Further Details:      
 
Domain Number 2 Region: 1-27
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000446
Family C2HC finger 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YCR087C-A
Sequence length 148
Comment ORF Uncharacterized Putative protein of unknown function; green fluorescent protein (GFP)-fusion protein localizes to the nucleolus; YCR087C-A is not an essential gene
Sequence
MVTFNCEVCNDTVPKKNTEKHYYRCPNAYYTCIDCSKTFEDGVSYKNHTSCISEDEKYQK
ALYKGNKKQKQKQQQKQQQQPVATPAKKVEKPVIKKAEKVEKTSNGIELHKGKSLYKILK
TMKDKGAKKTFLKSLVVDSEGQIRYAKE
Download sequence
Identical sequences A0A0L8VUM7 A6ZTQ8 B3LUE0 C7GUW2 C8Z4H4 E7KA77 E7KKZ3 E7LS19 E7QC80
YCR087C-A YCR087C-A XP_015331802.1.40921 YCR087C-A YCR087C-A YCR087C-A YCR087C-A tr|A6ZTQ8|A6ZTQ8_YEAS7 SCRT_05475 YCR087C-A YCR087C-A YCR087C-A YCR087C-A YCR087C-A YCR087C-A YCR087C-A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]