SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL030W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL030W
Domain Number 1 Region: 273-325
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000333
Family HkH motif-containing C2H2 finger 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YDL030W
Sequence length 530
Comment PRP9 ORF Verified Subunit of the SF3a splicing factor complex, required for spliceosome assembly; acts after the formation of the U1 snRNP-pre-mRNA complex
Sequence
MNLLETRRSLLEEMEIIENAIAERIQRNPELYYHYIQESSKVFPDTKLPRSSLIAENKIY
KFKKVKRKRKQIILQQHEINIFLRDYQEKQQTFNKINRPEETQEDDKDLPNFERKLQQLE
KELKNEDENFELDINSKKDKYALFSSSSDPSRRTNILSDRARDLDLNEIFTRDEQYGEYM
ELEQFHSLWLNVIKRGDCSLLQFLDILELFLDDEKYLLTPPMDRKNDRYMAFLLKLSKYV
ETFFFKSYALLDAAAVENLIKSDFEHSYCRGSLRSEAKGIYCPFCSRWFKTSSVFESHLV
GKIHKKNESKRRNFVYSEYKLHRYLKYLKDEFSRTRSFVERKLAFTANERMAEMDILTQK
YEAPAYDSTEKEGAEQVDGEQRDGQLQEEHLSGKSFDMPLGPDGLPMPYWLYKLHGLDRE
YRCEICSNKVYNGRRTFERHFNEERHIYHLRCLGIEPSSVFKGITKIKEAQELWKNMQGQ
SQLTSIAAVPPKPNPSQLKVPTELELEEEDEEGNVMSKKVYDELKKQGLV
Download sequence
Identical sequences A0A0L8VSM7 A6ZXU1 C7GW51 C8Z4N8
YDL030W tr|A6ZXU1|A6ZXU1_YEAS7 YDL030W YDL030W YDL030W YDL030W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]