SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL043C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL043C
Domain Number 1 Region: 56-94
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000181
Family HkH motif-containing C2H2 finger 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDL043C
Sequence length 266
Comment PRP11 ORF Verified Subunit of the SF3a splicing factor complex, required for spliceosome assembly
Sequence
MNYLEGVGSKKGGGGIASESQFNLQRRKEVESLLSKGENVPYTFQDEKDDQVRSNPYIYK
NHSGKLVCKLCNTMHMSWSSVERHLGGKKHGLNVLRRGISIEKSSLGREGQTTHDFRQQQ
KIIEAKQSLKNNGTIPVCKIATVKNPKNGSVGLAIQVNYSSEVKENSVDSDDKAKVPPLI
RIVSGLELSDTKQKGKKFLVIAYEPFENIAIELPPNEILFSENNDMDNNNDGVDELNKKC
TFWDAISKLYYVQFFFKQAEQEQADV
Download sequence
Identical sequences A0A0L8VT85 B3LGU1 B5VFM4 C7GPW2 C8Z4M7 E7KL36 E7QCL5 H0GDU0 N1P7T3 Q07350
5gm6_I 5nrl_U 5zwm_v 5zwo_v 4932.YDL043C YDL043C YDL043C YDL043C YDL043C YDL043C YDL043C SCRT_00542 YDL043C YDL043C YDL043C YDL043C YDL043C 355230 NYSGXRC-P028 YDL043C NP_010241.1.97178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]