SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL048C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL048C
Domain Number 1 Region: 277-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000175
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDL048C
Sequence length 490
Comment STP4 ORF Verified Protein containing a Kruppel-type zinc-finger domain; has similarity to Stp1p, Stp2p, and Stp3p
Sequence
MPVSSSFASSIDSVMSHETMSLRRNPPFIDTPEKMPNPTASPNGTIHHLIDPSLPLLSST
TSSSRSTLSSTLNSPPPPPLTTSYSSYNSSACQSITSSPTDNTALAHNSKCYFPHSLSPT
PLSSNSSSHVILPPISSFTNLITVAEREFNGRSNSLHANFTSPVPRTVLDHHRHELTFCN
PNNTTGFKTITPSPPTQHQSILPTAVDNVPRSKSVSSLPVSGFPPLIVKQQQQQQLNSSS
SASALPSIHSPLTNEHTSRYSSSLKDSAKITKQRKKKECPICHNFYANLSTHKSTHLTPE
DRPHKCPICQRGFARNNDLIRHKKRHWKDEFMQIYARESDNNSGADDQDDTARTSANNDS
DDSNDKLAASSSSEETKLLKKNQLKSLYKIKGAFKCPYNSTLINLDMEVYPHKSISLYFE
PINCHQTGVFSRCDTFKNHLKALHFEYPPKTKKEDRGVVPGKCKHCGLQFPNVDVWLNKH
VGKGCGYSYH
Download sequence
Identical sequences B5VFL8 C7GW86 C8Z4M1 H0GDT5
YDL048C YDL048C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]