SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDL098C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDL098C
Domain Number 1 Region: 79-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000217
Family Classic zinc finger, C2H2 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDL098C
Sequence length 194
Comment SNU23 ORF Verified Component of U4/U6.U5 snRNP involved in mRNA splicing via spliceosome
Sequence
MSNFGRRTWDREEYAEQARSGYDDRSLKATLTPIELQALKSKYTNYDHLIKGSLKDLNKR
KLTANTESLSSFKRGKKFGFYCDICNLTFKDTLQYIDHLNHKVHAIKFENLFDEPLIIDI
RDNDDVPQEEFELCYHNLIKDFVEVRSMETQSKRKRLLDTDVEKAKKVATKPSIESESKV
SQMMGFSNFATSKK
Download sequence
Identical sequences A0A0L8VSG7 A0A250WA79 A6ZXN1 B3LGZ1 C7GJL8 E7LSE4 E7QCI0 G2WC66 N1PA94 Q12368
tr|A6ZXN1|A6ZXN1_YEAS7 YDL098C YDL098C YDL098C YDL098C YDL098C YDL098C 4932.YDL098C YDL098C YDL098C YDL098C YDL098C YDL098C YDL098C YDL098C SCRT_00593 5nrl_L 5zwo_W YDL098C YDL098C YDL098C NP_010185.1.97178 355235 YDL098C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]