SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR043C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR043C
Domain Number 1 Region: 172-226
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000544
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR043C
Sequence length 231
Comment NRG1 ORF Verified Transcriptional repressor that recruits the Cyc8p-Tup1p complex to promoters; mediates glucose repression and negatively regulates a variety of processes including filamentous growth and alkaline pH response
Sequence
MFYPYNYSNLNVSTMPALPGISAFDGMQDEENVEISPERKYQTLLPVLTNSHVVENELKH
KLNKTAFDFRYQTKSENGSEKWEPKYLITPNLQTRSVSFDNSSVQYNSDSSEKSSLSQLT
CNSSIIQQPENGIVSNDAYNKMANSRYSLKTRKQRTDPRNTLSDEEDLEQRRKYICKICA
RGFTTSGHLARHNRIHTGEKNHCCPYKGCTQRFSRHDNCLQHYRTHLKKGQ
Download sequence
Identical sequences A0A0L8VTD6 B3LGM4 B5VFU5 C7GTA6 C8Z4W3 E7KAP4 E7QCQ6 G2WAE8 Q03125
YDR043C YDR043C YDR043C YDR043C YDR043C YDR043C YDR043C YDR043C YDR043C 4932.YDR043C SCRT_00470 YDR043C YDR043C YDR043C NP_010328.3.97178 YDR043C YDR043C YDR043C YDR043C YDR043C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]