SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR049W from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR049W
Domain Number 1 Region: 468-511
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000195
Family Ankyrin repeat 0.0055
Further Details:      
 
Weak hits

Sequence:  YDR049W
Domain Number - Region: 65-102
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000101
Family HkH motif-containing C2H2 finger 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR049W
Sequence length 632
Comment VMS1 ORF Uncharacterized Zinc finger protein; putative transcription factor that may interact with proteins involved in histone acetylation or deacetylation; may be involved in altering acetylation on histone lysines
Sequence
MNSQKASKMTGSLKKNDLYIFDLSEQLLNSLKLMSFDSTLREVEVEKTSDNDRNKESGDL
QIARKKVTSNVMRCSVCQMSFDSRNEQKAHYQTDYHLMNVKRNLRGLDILSVEEFDALIS
KEHGIKSEDENSDGEQTSSDHEESEEASDRDPDLQTNNYMETIIENDLQKLGFQKDESDA
ISHINTQSPYIYFKSKYLQKNEVLAIYKSLFNKRSLSNPNEALTFWNSQENPMAISALFM
VGGGHFAGAIVSHQRLNVKGNAHKKDETLIEQAVNFLEHKTFHRYTTRRKQGGSQSAMDN
AKGKANSAGSALRRYNESALKTDIQGVLKDWEPYLSKCDNIFIRARNVSDKKIFTDNTVL
NKGDERIKSFPFTTNRPTVLELKKAWCELSYLKILPKPEPLAVKETVQKLEVSNKKDEFK
EKQEPLLEEIQTEEIISLLKKGRAPLLISFLKKNKLDGNFRLKPESKYSLTPTMLHYASQ
QGMKQMALILLSNIKCDPTIKNRLGRTAWDLNRNDDVRHAFQIARYNLGESFTNWDETHI
GQPLSREQVDEINEKKKAIENEKAEKLIKLELEAAKEKQRFAKDAERGPGKKLTNIPSIE
QQNLNSLTDEQRRRLMREQRARAAEERMKKKY
Download sequence
Identical sequences C7GTA1
YDR049W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]