SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR052C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YDR052C
Domain Number - Region: 184-223
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.00183
Family DNA polymerase beta, N-terminal domain-like 0.022
Further Details:      
 
Domain Number - Region: 658-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0754
Family HkH motif-containing C2H2 finger 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) YDR052C
Sequence length 704
Comment DBF4 ORF Verified Regulatory subunit of Cdc7p-Dbf4p kinase complex, required for Cdc7p kinase activity and initiation of DNA replication; phosphorylates the Mcm2-7 family of proteins; cell cycle regulated
Sequence
MVSPTKMIIRSPLKETDTNLKHNNGIAASTTAAGHLNVFSNDNNCNNNNTTESFPKKRSL
ERLELQQQQHLHEKKRARIERARSIEGAVQVSKGTGLKNVEPRVTPKELLEWQTNWKKIM
KRDSRIYFDITDDVEMNTYNKSKMDKRRDLLKRGFLTLGAQITQFFDTTVTIVITRRSVE
NIYLLKDTDILSRAKKNYMKVWSYEKAARFLKNLDVDLDHLSKTKSASLAAPTLSNLLHN
EKLYGPADRDPRTKRDDIHYFKYPHVYLYDLWQTWAPIITLEWKPQELTNLDELPYPILK
IGSFGRCPFIGDRNYDESSYKRVVKRYSRDKANKKYALQLRALFQYHADTLLNTSSVNDQ
TKNLIFIPHTCNDSTKSFKKWMQEKAKNIEKTELKKTDDSAVQDVRNEHADQTDEKNSIL
LNETETKEPPLKEEKENKQSIAEESNKYPQRKELAATPKLNHPVLATFARQETEEVPDDL
CTLKTKSRQAFEIKASGAHQSNDVATSFGNGLGPTRASVMSKNMKSLSRLMVDRKLGVKQ
TNGNNKNYTATIATTAETSKENRHRLDFNALKKDEAPSKETGKDSAVHLETNRKPQNFPK
VATKSVSADSKVHNDIKITTTESPTASKKSTSTNVTLHFNAQTAQTAQPVKKETVKNSGY
CENCRVKYESLEQHIVSEKHLSFAENDLNFEAIDSLIENLRFQI
Download sequence
Identical sequences C7GT98
YDR052C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]