SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YDR228C from Saccharomyces cerevisiae JAY291

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR228C
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.92e-44
Family RPR domain (SMART 00582 ) 0.000000237
Further Details:      
 
Weak hits

Sequence:  YDR228C
Domain Number - Region: 211-274
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000165
Family beta-sandwich domain of Sec23/24 0.035
Further Details:      
 
Domain Number - Region: 414-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0447
Family Classic zinc finger, C2H2 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) YDR228C
Sequence length 626
Comment PCF11 ORF Verified mRNA 3' end processing factor, essential component of cleavage and polyadenylation factor IA (CF IA), involved in pre-mRNA 3' end processing and in transcription termination; binds C-terminal domain of largest subunit of RNA pol II (Rpo21p)
Sequence
MDHDTEVIVKDFNSILEELTFNSRPIITTLTKLAEENISCAQYFVDAIESRIEKCMPKQK
LYAFYALDSICKNVGSPYTIYFSRNLFNLYKRTYLLVDNTTRTKLINMFKLWLNPNDTGL
PLFEGSALEKIEQFLIKASALHQKNLQAMLPTPTVPLLLRDIDKLTCLTSERLKNQPNDE
KLKMKLLVLSQLKQELKREKLTLNALKQVQMQLRQVFSQDQQVLQERMRYHELQQQQQQQ
QQQQQQQQQQQQQYHETKDMVGSYTQNSNSAIPLFGNNSDTTNQQNSLSSSLFGNISGVE
SFQEIEKKKSLNKINNLYASLKAEGLIYTPPKESIVTLYKKLNGHSNYSLDSHEKQLMKN
LPKIPLLNDILSDCKAYFATVNIDVLNNPSLQLSEQTLLQENPIVQNNLIHLLYRSKPNK
CSVCGKRFGNSESEKLLQNEHLDWHFRINTRIKGSQNTANTGISNSNLNTTTTRKNIQSR
NWYLSDSQWAAFKDDEITSTKHKNDYTDPHANKNIDKSALNIHADENDEGSVDNTLGSDR
SNELKIRGKYVVVPETSQDMAFKCPICKETVTGVYDEESGEWVWKNTIEVNGKYFHSTCY
HETSQNSSKSNSGKVGLDDLKKLVTK
Download sequence
Identical sequences A0A0L8VTF6 A6ZYI2 B3LG59 B5VGB5 C7GVC4 C8Z5D9
SCRT_00296 YDR228C tr|A6ZYI2|A6ZYI2_YEAS7 YDR228C YDR228C YDR228C YDR228C YDR228C YDR228C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]